Recombinant Human TLX3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O43711

Gene Name: TLX3

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Leu181

End Site: Asp280

Coverage: 0.35

Isoelectric Point: 10

Core Sequence: LEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQASRLMLQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPWEED

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 66%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: HOX11L2

Alternative protein names: T-cell leukemia homeobox protein 3; Homeobox protein Hox-11L2

Protein name: T cell leukemia homeobox 3

Full length: 291 amino acids

Entry name: TLX3_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-4272-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4272-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 30012