Recombinant Human TMC2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8TDI7

Gene Name: TMC2

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 70%

Start Site: Thr111

End Site: Phe190

Coverage: 0.10

Isoelectric Point: 10

Core Sequence: TAAPKREKEIPRREEKSKRQKKPRSSSLASSASGGESLSEEELAQILEQVEEKKKLIATMRSKPWPMAKKLTELREAQEF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 70%, Pig - 79%, Cynomolgus monkey - 93%

Alternative gene names: C20orf145

Alternative protein names: Transmembrane channel-like protein 2; Transmembrane cochlear-expressed protein 2

Protein name: transmembrane channel like 2

Full length: 906 amino acids

Entry name: TMC2_HUMAN

• SKU: ASBPP-334-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-334-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 117532