Recombinant Human TMCO4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q5TGY1

Gene Name: TMCO4

Expression System: Escherichia coli

Molecular Weight: 29 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 78%

Start Site: Gly381

End Site: Ser630

Coverage: 0.41

Isoelectric Point: 7

Core Sequence: GKHLAHILLSRQQGRRPVTLIGFSLGARVIYFCLQEMAQEKDCQGIIEDVILLGAPVEGEAKHWEPFRKVVSGRIINGYCRGDWLLSFVYRTSSVQLRVAGLQPVLLQDRRVENVDLTSVVSGHLDYAKQMDAILKAVGIRTKPGWDEKGLLLAPGCLPSEEPRQAAAAASSGETPHQVGQTQGPISGDTSKLAMSTDPSQAQVPVGLDQSEGASLPAAASPERPPICSHGMDPNPLGCPDCACKTQGPS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 78%, Rat - 79%, Pig - 85%, Cynomolgus monkey - 95%

Alternative gene names: /

Alternative protein names: Transmembrane and coiled-coil domain-containing protein 4

Protein name: transmembrane and coiled-coil domains 4

Full length: 634 amino acids

Entry name: TMCO4_HUMAN

• SKU: ASBPP-3039-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3039-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 255104