Recombinant Human TMEM132A Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q24JP5

Gene Name: TMEM132A

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 87%

Start Site: Pro881

End Site: Arg1020

Coverage: 0.15

Isoelectric Point: 5.5

Core Sequence: PDSATDPTSPQPHNWVWLGTDQEELSRQLDRQSPGPPKGEGSCPCESGGGGEAPTLAPGPPGGTTSSSSTLARKEAGGRRKRVEFVTFAPAPPAQSPEEPVGAPAVQSILVAGEEDIRWVCEDMGLKDPEELRNYMERIR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 87%, Rat - 82%, Pig - 89%, Cynomolgus monkey - 30%

Alternative gene names: HSPA5BP1; KIAA1583

Alternative protein names: Transmembrane protein 132A; HSPA5-binding protein 1

Protein name: transmembrane protein 132A

Full length: 1023 amino acids

Entry name: T132A_HUMAN

• SKU: ASBPP-4304-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4304-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 54972