Recombinant Human TMEM161B Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8NDZ6

Gene Name: TMEM161B

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Gln41

End Site: Tyr100

Coverage: 0.14

Isoelectric Point: 7

Core Sequence: QHPTEEELRILAGKQQKGKTKKDRKYNGHIESKPLTIPKDIDLHLETKSVTEVDTLALHY

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Pig - 96%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Transmembrane protein 161B

Protein name: transmembrane protein 161B

Full length: 487 amino acids

Entry name: T161B_HUMAN

• SKU: ASBPP-3270-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3270-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 153396