Recombinant Human TMEM184C Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NVA4

Gene Name: TMEM184C

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 69%

Start Site: Ala321

End Site: Glu430

Coverage: 0.28

Isoelectric Point: 5.5

Core Sequence: AEEGSCFDSFLAMWDVSDIRDDISEQVRHVGRTVRGHPRKKLFPEDQDQNEHTSLLSSSSQDAISIASSMPPSPMGHYQGFGHTVTPQTTPTTAKISDEILSDTIGEKKE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 69%, Rat - 63%, Pig - 89%, Cynomolgus monkey - 98%

Alternative gene names: TMEM34

Alternative protein names: Transmembrane protein 184C; Transmembrane protein 34

Protein name: transmembrane protein 184C

Full length: 438 amino acids

Entry name: T184C_HUMAN

• SKU: ASBPP-3341-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3341-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 55751