Recombinant Human TMEM215 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q68D42

Gene Name: TMEM215

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Glu71

End Site: Lys210

Coverage: 0.67

Isoelectric Point: 6

Core Sequence: ENELLWVRKLPCFRKPKDKEVVELLRTPSDLESGKGSSDELAKKAGLRGKPPPQSQGEVSVASSINSPTPTEEGECQSLVQNGHQEETSRYLDGYCPSGSSLTYSALDVKCSARDRSECPEPEDSIFFVPQDSIIVCSYK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Pig - 91%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Transmembrane protein 215

Protein name: transmembrane protein 215

Full length: 235 amino acids

Entry name: TM215_HUMAN

• SKU: ASBPP-3474-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3474-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 401498