Recombinant Human TMEM30A Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NV96

Gene Name: TMEM30A

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Glu111

End Site: Ser280

Coverage: 0.47

Isoelectric Point: 8

Core Sequence: EKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Rat - 86%, Pig - 89%, Cynomolgus monkey - 99%

Alternative gene names: C6orf67; CDC50A

Alternative protein names: Cell cycle control protein 50A; P4-ATPase flippase complex beta subunit TMEM30A; Transmembrane protein 30A

Protein name: transmembrane protein 30A

Full length: 361 amino acids

Entry name: CC50A_HUMAN

• SKU: ASBPP-3187-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3187-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 55754