Recombinant Human TMEM63B Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q5T3F8

Gene Name: TMEM63B

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Thr241

End Site: Glu400

Coverage: 0.20

Isoelectric Point: 8

Core Sequence: TLFINGISKYAESEKIKKHFEEAYPNCTVLEARPCYNVARLMFLDAERKKAERGKLYFTNLQSKENVPTMINPKPCGHLCCCVVRGCEQVEAIEYYTKLEQKLKEDYKREKEKVNEKPLGMAFVTFHNETITAIILKDFNVCKCQGCTCRGEPRPSSCSE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 38%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: C6orf110

Alternative protein names: CSC1-like protein 2; Transmembrane protein 63B

Protein name: transmembrane protein 63B

Full length: 832 amino acids

Entry name: CSCL2_HUMAN

• SKU: ASBPP-3170-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3170-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 55362