Recombinant Human TMEM79 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BSE2

Gene Name: TMEM79

Expression System: Escherichia coli

Molecular Weight: 22.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 73%

Start Site: Glu11

End Site: Ala200

Coverage: 0.50

Isoelectric Point: 4.5

Core Sequence: EVKRSDSPEKSSPQALVPNGRQPEGEGGAESPGAESLRVGSSAGSPTAIEGAEDGLDSTVSEAATLPWGTGPQPSAPFPDPPGWRDIEPEPPESEPLTKLEELPEDDANLLPEKAARAFVPIDLQCIERQPQEDLIVRCEAGEGECRTFMPPRVTHPDPTERKWAEAVVRPPGCSCGGCGSCGDREWLRA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 73%, Rat - 72%, Pig - 81%, Cynomolgus monkey - 97%

Alternative gene names: MATT

Alternative protein names: Transmembrane protein 79; Mattrin

Protein name: transmembrane protein 79

Full length: 394 amino acids

Entry name: TMM79_HUMAN

• SKU: ASBPP-3445-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3445-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 84283