Recombinant Human TNFRSF12A Protein

Recombinant Human TNFRSF12A Protein
SKU
ASBPP-3362-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NP84

Gene Name: TNFRSF12A

Expression System: Escherichia coli

Molecular Weight: 18 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Pro31

End Site: Pro80

Coverage: 0.51

Isoelectric Point: 6

Core Sequence: PGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Pig - 91%

Alternative gene names: FN14

Alternative protein names: Tumor necrosis factor receptor superfamily member 12A; Fibroblast growth factor-inducible immediate-early response protein 14; FGF-inducible 14; Tweak-receptor; TweakR; CD antigen CD266

Protein name: TNF receptor superfamily member 12A

Full length: 129 amino acids

Entry name: TNR12_HUMAN

CD Antigen: CD266

Product panel: CD Antigen
More Information
SKU ASBPP-3362-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3362-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 51330
Product information (PDF)
×
MSDS (PDF)
×