Note: Dry Ice fees will be extra-charged
Uniprot: P43489
Gene Name: TNFRSF4
Expression System: Escherichia coli
Molecular Weight: 10 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 63%
Start Site: Cys141
End Site: Pro210
Coverage: 0.32
Isoelectric Point: 7
Core Sequence: CKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVP
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 63%, Rat - 62%, Pig - 75%, Cynomolgus monkey - 95%
Alternative gene names: TXGP1L
Alternative protein names: Tumor necrosis factor receptor superfamily member 4; ACT35 antigen; OX40L receptor; TAX transcriptionally-activated glycoprotein 1 receptor; CD antigen CD134
Protein name: TNF receptor superfamily member 4
Full length: 277 amino acids
Entry name: TNR4_HUMAN
CD Antigen: CD134
Product panel: CD Antigen,DNA binding & Chromatin
English
Deutsch
