Recombinant Human TOX2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96NM4

Gene Name: TOX2

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 81%

Start Site: Ser221

End Site: Lys320

Coverage: 0.23

Isoelectric Point: 10

Core Sequence: SEVHFKISGEKRPSADPGKKAKNPKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPSATFGDVSKIVASMWDSLGEEQKQSSPDQGETKSTQANPPAK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 81%, Rat - 75%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: C20orf100; GCX1

Alternative protein names: TOX high mobility group box family member 2; Granulosa cell HMG box protein 1; GCX-1

Protein name: TOX high mobility group box family member 2

Full length: 488 amino acids

Entry name: TOX2_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3376-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3376-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 84969