Recombinant Human TOX4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O94842

Gene Name: TOX4

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Ser181

End Site: Lys280

Coverage: 0.18

Isoelectric Point: 10.5

Core Sequence: SSLHEDGVEDFRRQLPSQKTVVVEAGKKQKAPKKRKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 96%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: C14orf92; KIAA0737

Alternative protein names: TOX high mobility group box family member 4; Epidermal Langerhans cell protein LCP1

Protein name: TOX high mobility group box family member 4

Full length: 621 amino acids

Entry name: TOX4_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3630-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3630-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 9878