Recombinant Human TPTE Protein

Recombinant Human TPTE Protein
SKU
ASBPP-318-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P56180

Gene Name: TPTE

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Ala11

End Site: Lys80

Coverage: 0.15

Isoelectric Point: 5.5

Core Sequence: AGVIIELGPNDSPQTSEFKGATEEAPAKESPHTSEFKGAARVSPISESVLARLSKFEVEDAENVASYDSK

Homologies: Highest protein sequence identity to the following orthologs: Cynomolgus monkey - 70%

Alternative gene names: /

Alternative protein names: Putative tyrosine-protein phosphatase TPTE; Cancer/testis antigen 44; CT44; Transmembrane phosphatase with tensin homology; Tumor antigen BJ-HCC-5

Protein name: transmembrane phosphatase with tensin homology

Full length: 551 amino acids

Entry name: TPTE_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-318-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-318-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 7179
Product information (PDF)
×
MSDS (PDF)
×