Recombinant Human TREX2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BQ50

Gene Name: TREX2

Expression System: Escherichia coli

Molecular Weight: 15.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 88%

Start Site: Leu51

End Site: Tyr170

Coverage: 0.55

Isoelectric Point: 6

Core Sequence: LVLPRVLDKLTLCMCPERPFTAKASEITGLSSEGLARCRKAGFDGAVVRTLQAFLSRQAGPICLVAHNGFDYDFPLLCAELRRLGARLPRDTVCLDTLPALRGLDRAHSHGTRARGRQGY

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 88%, Pig - 92%, Cynomolgus monkey - 95%

Alternative gene names: /

Alternative protein names: Three prime repair exonuclease 2; 3'-5' exonuclease TREX2

Protein name: three prime repair exonuclease 2

Full length: 236 amino acids

Entry name: TREX2_HUMAN

Product panel: DNA binding & Chromatin,Enzyme

• SKU: ASBPP-4032-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4032-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 11219