Recombinant Human TRGC2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P03986

Gene Name: TRGC2

Expression System: Escherichia coli

Molecular Weight: 18.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 68%

Start Site: Lys11

End Site: Thr150

Coverage: 0.79

Isoelectric Point: 6

Core Sequence: KPTIFLPSIAETKLQKAGTYLCLLEKFFPDIIKIHWQEKKSNTILGSQEGNTMKTNDTYMKFSWLTVPEESLDKEHRCIVRHENNKNGIDQEIIFPPIKTDVTTVDPKYNYSKDANDVITMDPKDNWSKDANDTLLLQLT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 68%, Rat - 29%

Alternative gene names: TCRGC2

Alternative protein names: T cell receptor gamma constant 2

Protein name: T cell receptor gamma constant 2

Full length: 189 amino acids

Entry name: TRGC2_HUMAN

• SKU: ASBPP-3316-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3316-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 6967