Recombinant Human TRIM72 Protein

Recombinant Human TRIM72 Protein
SKU
ASBPP-4251-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q6ZMU5

Gene Name: TRIM72

Expression System: Escherichia coli

Molecular Weight: 24 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 88%

Start Site: Phe281

End Site: Val470

Coverage: 0.42

Isoelectric Point: 7

Core Sequence: FRALMPALEELTFDPSSAHPSLVVSSSGRRVECSEQKAPPAGEDPRQFDKAVAVVAHQQLSEGEHYWEVDVGDKPRWALGVIAAEAPRRGRLHAVPSQGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 88%, Rat - 86%, Pig - 91%, Cynomolgus monkey - 61%

Alternative gene names: MG53

Alternative protein names: Tripartite motif-containing protein 72; Mitsugumin-53; Mg53

Protein name: tripartite motif containing 72

Full length: 477 amino acids

Entry name: TRI72_HUMAN

Product panel: E3 Ligase
More Information
SKU ASBPP-4251-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4251-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 493829
Product information (PDF)
×
MSDS (PDF)
×