Recombinant Human TRIT1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H3H1

Gene Name: TRIT1

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Ile371

End Site: Asp460

Coverage: 0.24

Isoelectric Point: 9

Core Sequence: IQGHKPTATPIKMPYNEAENKRSYHLCDLCDRIIIGDREWAAHIKSKSHLNQLKKRRRLDSDAVNTIESQSVSPDHNKEPKEKGSPGQND

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Pig - 75%

Alternative gene names: IPT; MOD5

Alternative protein names: tRNA dimethylallyltransferase; Isopentenyl-diphosphate:tRNA isopentenyltransferase; IPP transferase; IPPT; hGRO1; tRNA isopentenyltransferase 1; IPTase

Protein name: tRNA isopentenyltransferase 1

Full length: 467 amino acids

Entry name: MOD5_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3734-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3734-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 54802