Recombinant Human TRMT10A Protein

Recombinant Human TRMT10A Protein
SKU
ASBPP-10376-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8TBZ6

Gene Name: TRMT10A

Expression System: Escherichia coli

Molecular Weight: 40 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 77%

Start Site: Glu11

End Site: Thr330

Coverage: 0.97

Isoelectric Point: 8

Core Sequence: ETSNVDKKQGINEDQEESQKPRLGEGCEPISKRQMKKLIKQKQWEEQRELRKQKRKEKRKRKKLERQCQMEPNSDGHDRKRVRRDVVHSTLRLIIDCSFDHLMVLKDIKKLHKQIQRCYAENRRALHPVQFYLTSHGGQLKKNMDENDKGWVNWKDIHIKPEHYSELIKKEDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHAQLPLGNFVKMNSRKVLAVNHVFEIILEYLETRDWQEAFFTILPQRKGAVPTDKACESASHDNQSVRMEEGGSDSDSSEEEYSRNELDSPHEEKQDKENHT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 77%, Rat - 77%, Pig - 89%, Cynomolgus monkey - 96%

Alternative gene names: RG9MTD2

Alternative protein names: tRNA methyltransferase 10 homolog A; RNA; guanine-9-)-methyltransferase domain-containing protein 2; tRNA; guanine(9)-N(1))-methyltransferase TRMT10A

Protein name: tRNA methyltransferase 10A

Full length: 339 amino acids

Entry name: TM10A_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-10376-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10376-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 93587
Product information (PDF)
×
MSDS (PDF)
×