Recombinant Human TRPA1 Protein

Recombinant Human TRPA1 Protein
SKU
ASBPP-4332-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O75762

Gene Name: TRPA1

Expression System: Escherichia coli

Molecular Weight: 19.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 63%

Start Site: Val21

End Site: Ile170

Coverage: 0.14

Isoelectric Point: 5.5

Core Sequence: VYEDVPDDTEDFKESLKVVFEGSAYGLQNFNKQKKLKRCDDMDTFFLHYAAAEGQIELMEKITRDSSLEVLHEMDDYGNTPLHCAVEKNQIESVKFLLSRGANPNLRNFNMMAPLHIAVQGMNNEVMKVLLEHRTIDVNLEGENGNTAVI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 63%, Rat - 63%, Pig - 70%, Cynomolgus monkey - 92%

Alternative gene names: ANKTM1

Alternative protein names: Transient receptor potential cation channel subfamily A member 1; Ankyrin-like with transmembrane domains protein 1; Transformation-sensitive protein p120; p120; Wasabi receptor

Protein name: transient receptor potential cation channel subfamily A member 1

Full length: 1119 amino acids

Entry name: TRPA1_HUMAN

Product panel: Neuroscience Biomarkers
More Information
SKU ASBPP-4332-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4332-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 8989
Product information (PDF)
×
MSDS (PDF)
×