Recombinant Human TRPC1 Protein

Recombinant Human TRPC1 Protein
SKU
ASBPP-303-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P48995

Gene Name: TRPC1

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Val31

End Site: Leu100

Coverage: 0.10

Isoelectric Point: 5

Core Sequence: VMALKDVREVKEENTLNEKLFLLACDKGDYYMVKKILEENSSGDLNINCVDVLGRNAVTITIENENLDIL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: TRP1

Alternative protein names: Short transient receptor potential channel 1; TrpC1; Transient receptor protein 1; TRP-1

Protein name: transient receptor potential cation channel subfamily C member 1

Full length: 793 amino acids

Entry name: TRPC1_HUMAN
More Information
SKU ASBPP-303-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-303-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 7220
Product information (PDF)
×
MSDS (PDF)
×