Recombinant Human TRPM2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O94759

Gene Name: TRPM2

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 72%

Start Site: Asn1131

End Site: Lys1230

Coverage: 0.07

Isoelectric Point: 5

Core Sequence: NYLQNRQFQQKQRPEQKIEDISNKVDAMVDLLDLDPLKRSGSMEQRLASLEEQVAQTAQALHWIVRTLRASGFSSEADVPTLASQKAAEEPDAEPGGRKK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 72%, Rat - 70%, Pig - 70%, Cynomolgus monkey - 93%

Alternative gene names: EREG1; KNP3; LTRPC2; TRPC7

Alternative protein names: Transient receptor potential cation channel subfamily M member 2; Estrogen-responsive element-associated gene 1 protein; Long transient receptor potential channel 2; LTrpC-2; LTrpC2; Transient receptor potential channel 7; TrpC7; Transient receptor potential melastatin 2

Protein name: transient receptor potential cation channel subfamily M member 2

Full length: 1503 amino acids

Entry name: TRPM2_HUMAN

Product panel: Neuroscience Biomarkers

• SKU: ASBPP-3525-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3525-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 7226