Recombinant Human TRPV2 Protein

Recombinant Human TRPV2 Protein
SKU
ASBPP-3369-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y5S1

Gene Name: TRPV2

Expression System: Escherichia coli

Molecular Weight: 39.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 83%

Start Site: Arg11

End Site: Leu340

Coverage: 0.45

Isoelectric Point: 6.5

Core Sequence: RLETLDGGQEDGSEADRGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNYRKGTGASQPDPNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDSEYTEGSTGKTCLMKAVLNLKDGVNACILPLLQIDRDSGNPQPLVNAQCTDDYYRGHSALHIAIEKRSLQCVKLLVENGANVHARACGRFFQKGQGTCFYFGELPLSLAACTKQWDVVSYLLENPHQPASLQATDSQGNTVLHALVMISDNSAENIALVTSMYDGLLQAGARLCPTVQLEDIRNLQDLTPLKLAAKEGKIEIFRHILQREFSGLSHLSRKFTEWCYGPVRVSL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 83%, Rat - 78%, Pig - 80%, Cynomolgus monkey - 95%

Alternative gene names: VRL

Alternative protein names: Transient receptor potential cation channel subfamily V member 2; TrpV2; Osm-9-like TRP channel 2; OTRPC2; Vanilloid receptor-like protein 1; VRL-1

Protein name: transient receptor potential cation channel subfamily V member 2

Full length: 764 amino acids

Entry name: TRPV2_HUMAN
More Information
SKU ASBPP-3369-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3369-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 51393
Product information (PDF)
×
MSDS (PDF)
×