Recombinant Human TRRAP Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y4A5

Gene Name: TRRAP

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: His2531

End Site: Leu2610

Coverage: 0.02

Isoelectric Point: 6.5

Core Sequence: HDRAAFAMVTHVKQEPRERENSESKEEDVEIDIELAPGDQTSTPKTKELSEKDIGNQLHMLTNRHDKFLDTLREVKTGAL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: PAF400

Alternative protein names: Transformation/transcription domain-associated protein; 350/400 kDa PCAF-associated factor; PAF350/400; STAF40; Tra1 homolog

Protein name: transformation/transcription domain associated protein

Full length: 3859 amino acids

Entry name: TRRAP_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3053-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3053-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 8295