Recombinant Human TSHZ2 Protein

Recombinant Human TSHZ2 Protein
SKU
ASBPP-10367-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NRE2

Gene Name: TSHZ2

Expression System: Escherichia coli

Molecular Weight: 48 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Gln241

End Site: Pro650

Coverage: 0.40

Isoelectric Point: 7.5

Core Sequence: QDDNRKKDKLRPTSYSKPRKRAFQDMDKEDAQKVLKCMFCGDSFDSLQDLSVHMIKTKHYQKVPLKEPVPTISSKMVTPAKKRVFDVNRPCSPDSTTGSFADSFSSQKNANLQLSSNNRYGYQNGASYTWQFEACKSQILKCMECGSSHDTLQQLTTHMMVTGHFLKVTSSASKKGKQLVLDPLAVEKMQSLSEAPNSDSLAPKPSSNSASDCTASTTELKKESKKERPEETSKDEKVVKSEDYEDPLQKPLDPTIKYQYLREEDLEDGSKGGGDILKSLENTVTTAINKAQNGAPSWSAYPSIHAAYQLSEGTKPPLPMGSQVLQIRPNLTNKLRPIAPKWKVMPLVSMPTHLAPYTQVKKESEDKDEAVKECGKESPHEEASSFSHSEGDSFRKSETPPEAKKTELGP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 53%, Pig - 92%, Cynomolgus monkey - 97%

Alternative gene names: C20orf17; TSH2; ZNF218

Alternative protein names: Teashirt homolog 2; Ovarian cancer-related protein 10-2; OVC10-2; Zinc finger protein 218

Protein name: teashirt zinc finger homeobox 2

Full length: 1034 amino acids

Entry name: TSH2_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-10367-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10367-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 128553
Product information (PDF)
×
MSDS (PDF)
×