Recombinant Human Tumor necrosis factor ligand superfamily member 13B protein (TNFSF13B), partial

Recombinant Human Tumor necrosis factor ligand superfamily member 13B protein (TNFSF13B), partial
SKU
CSB-EP897523HU-20
Packaging Unit
20 µg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Research Areas: Cancer

Uniprot: Q9Y275

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal 6xHis-SUMO-tagged

Purity: Greater than 90% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 39.7 kDa

Gene Names: TNFSF13B

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 68-285aa

Protein Length: Extracellular Domain

Target Protein Sequence: QVAALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL

Endotoxin: Not test.

Relevance: Cytokine that binds to TNFRSF13B/TACI and TNFRSF17/BCMA. TNFSF13/APRIL binds to the same 2 receptors. Together, they form a 2 ligands -2 receptors pathway involved in the stimulation of B- and T-cell function and the regulation of humoral immunity. A third B-cell specific BAFF-receptor (BAFFR/BR3) promotes the survival of mature B-cells and the B-cell response.

Reference: TALL-1 is a novel member of the TNF family that is down-regulated by mitogens.Shu H.-B., Hu W.-H., Johnson H.J. Leukoc. Biol. 65:680-683(1999)

Function: Cytokine that binds to TNFRSF13B/TACI and TNFRSF17/BCMA. TNFSF13/APRIL binds to the same 2 receptors. Together, they form a 2 ligands -2 receptors pathway involved in the stimulation of B- and T-cell function and the regulation of humoral immunity. A third B-cell specific BAFF-receptor (BAFFR/BR3) promotes the survival of mature B-cells and the B-cell response.
More Information
SKU CSB-EP897523HU-20
Manufacturer Cusabio
Manufacturer SKU CSB-EP897523HU-20
Package Unit 20 µg
Quantity Unit STK
Product information (PDF) Download
MSDS (PDF) Download