Recombinant Human TXNL4B Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NX01

Gene Name: TXNL4B

Expression System: Escherichia coli

Molecular Weight: 29.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Met1

End Site: Ile149

Coverage: 1.00

Isoelectric Point: 6

Core Sequence: MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Pig - 97%, Cynomolgus monkey - 99%

Alternative gene names: DIM2; DLP

Alternative protein names: Thioredoxin-like protein 4B; Dim1-like protein

Protein name: thioredoxin like 4B

Full length: 149 amino acids

Entry name: TXN4B_HUMAN

• SKU: ASBPP-3634-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3634-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 54957