Recombinant Human UBL3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O95164

Gene Name: UBL3

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Asn11

End Site: Glu110

Coverage: 0.95

Isoelectric Point: 7

Core Sequence: NLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: PNSC1

Alternative protein names: Ubiquitin-like protein 3; Membrane-anchored ubiquitin-fold protein; HsMUB; MUB; Protein HCG-1

Protein name: ubiquitin like 3

Full length: 117 amino acids

Entry name: UBL3_HUMAN

• SKU: ASBPP-3371-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3371-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 5412