Recombinant Human UBR1 Protein

Recombinant Human UBR1 Protein
SKU
ASBPP-3388-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8IWV7

Gene Name: UBR1

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Thr1011

End Site: Glu1110

Coverage: 0.06

Isoelectric Point: 6.5

Core Sequence: THDKEKAERKRKAEAARLHRQKIMAQMSALQKNFIETHKLMYDNTSEMPGKEDSIMEEESTPAVSDYSRIALGPKRGPSVTEKEVLTCILCQEEQEVKIE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Pig - 96%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: E3 ubiquitin-protein ligase UBR1; N-recognin-1; RING-type E3 ubiquitin transferase UBR1; Ubiquitin-protein ligase E3-alpha-1; Ubiquitin-protein ligase E3-alpha-I

Protein name: ubiquitin protein ligase E3 component n-recognin 1

Full length: 1749 amino acids

Entry name: UBR1_HUMAN

Product panel: E3 Ligase,Enzyme
More Information
SKU ASBPP-3388-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3388-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 197131
Product information (PDF)
×
MSDS (PDF)
×