Recombinant Human UBXN8 Protein

Recombinant Human UBXN8 Protein
SKU
ASBPP-3300-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O00124

Gene Name: UBXN8

Expression System: Escherichia coli

Molecular Weight: 26 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 72%

Start Site: Ser61

End Site: Asn270

Coverage: 0.80

Isoelectric Point: 7

Core Sequence: SFKSPQVYLKEEEEKNEKRQKLVRKKQQEAQGEKASRYIENVLKPHQEMKLRKLEERFYQMTGEAWKLSSGHKLGGDEGTSQTSFETSNREAAKSQNLPKPLTEFPSPAEQPTCKEIPDLPEEPSQTAEEVVTVALRCPSGNVLRRRFLKSYSSQVLFDWMTRIGYHISLYSLSTSFPRRPLAVEGGQSLEDIGITVDTVLILEEKEQTN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 72%, Rat - 33%, Pig - 74%

Alternative gene names: D8S2298E; REP8; UBXD6

Alternative protein names: UBX domain-containing protein 8; Reproduction 8 protein; Rep-8 protein; UBX domain-containing protein 6

Protein name: UBX domain protein 8

Full length: 270 amino acids

Entry name: UBXN8_HUMAN
More Information
SKU ASBPP-3300-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3300-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 7993
Product information (PDF)
×
MSDS (PDF)
×