Recombinant Human UCMA Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8WVF2

Gene Name: UCMA

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 88%

Start Site: Glu71

End Site: Ser130

Coverage: 0.66

Isoelectric Point: 6

Core Sequence: EVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 88%, Rat - 88%, Pig - 91%, Cynomolgus monkey - 95%

Alternative gene names: C10orf49

Alternative protein names: Unique cartilage matrix-associated protein [Cleaved into: Unique cartilage matrix-associated protein C-terminal fragment; Ucma-C; Gla-rich protein; GRP]

Protein name: upper zone of growth plate and cartilage matrix associated

Full length: 138 amino acids

Entry name: UCMA_HUMAN

• SKU: ASBPP-4308-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4308-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 221044