Recombinant Human UHMK1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8TAS1

Gene Name: UHMK1

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Asp331

End Site: Val400

Coverage: 0.19

Isoelectric Point: 4.5

Core Sequence: DDYLENEEEYEDVVEDVKEECQKYGPVVSLLVPKENPGRGQVFVEYANAGDSKAAQKLLTGRMFDGKFVV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: KIS; KIST

Alternative protein names: Serine/threonine-protein kinase Kist; Kinase interacting with stathmin; PAM COOH-terminal interactor protein 2; P-CIP2; U2AF homology motif kinase 1

Protein name: U2AF homology motif kinase 1

Full length: 419 amino acids

Entry name: UHMK1_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3381-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3381-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 127933