Recombinant Human ULBP2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BZM5

Gene Name: ULBP2

Expression System: Escherichia coli

Molecular Weight: 27 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 26%

Start Site: Phe61

End Site: Glu170

Coverage: 0.64

Isoelectric Point: 6.5

Core Sequence: FLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 26%, Rat - 26%, Pig - 48%, Cynomolgus monkey - 93%

Alternative gene names: N2DL2; RAET1H

Alternative protein names: UL16-binding protein 2; ALCAN-alpha; NKG2D ligand 2; N2DL-2; NKG2DL2; Retinoic acid early transcript 1H

Protein name: UL16 binding protein 2

Full length: 246 amino acids

Entry name: ULBP2_HUMAN

• SKU: ASBPP-1791-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-1791-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 80328