Recombinant Human UNC80 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8N2C7

Gene Name: UNC80

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Lys3061

End Site: Gln3170

Coverage: 0.03

Isoelectric Point: 11.5

Core Sequence: KRGLRQLRRPLLSRQKTQTEPRNRQGARLSTTRRSIQPKTKPSADQKRSVTFIEAQPEPAAAPTDALPATGQLQGCSPAPSRKPEAMDEPVLTSSPAIVVADLHSVSPKQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Pig - 89%, Cynomolgus monkey - 97%

Alternative gene names: C2orf21; KIAA1843

Alternative protein names: Protein unc-80 homolog

Protein name: unc-80 homolog, NALCN channel complex subunit

Full length: 3258 amino acids

Entry name: UNC80_HUMAN

• SKU: ASBPP-3470-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3470-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 285175