Recombinant Human USP16 Protein

Recombinant Human USP16 Protein
SKU
ASBPP-2993-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y5T5

Gene Name: USP16

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Leu31

End Site: Pro190

Coverage: 0.20

Isoelectric Point: 7

Core Sequence: LEQGNLKKALVNVEWNICQDCKTDNKVKDKAEEETEEKPSVWLCLKCGHQGCGRNSQEQHALKHYLTPRSEPHCLVLSLDNWSVWCYVCDNEVQYCSSNQLGQVVDYVRKQASITTPKPAEKDNGNIELENKKLEKESKNEQEREKKENMAKENPPMNSP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Rat - 84%

Alternative gene names: /

Alternative protein names: Ubiquitin carboxyl-terminal hydrolase 16; Deubiquitinating enzyme 16; Ubiquitin thioesterase 16; Ubiquitin-processing protease UBP-M; Ubiquitin-specific-processing protease 16

Protein name: ubiquitin specific peptidase 16

Full length: 823 amino acids

Entry name: UBP16_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-2993-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2993-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 10600
Product information (PDF)
×
MSDS (PDF)
×