Recombinant Human UTF1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q5T230

Gene Name: UTF1

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 56%

Start Site: Gln131

End Site: Ser220

Coverage: 0.29

Isoelectric Point: 11.5

Core Sequence: QPPGPFDEQIRKLMGLLGDNGRKRPRRRSPGSGRPQRARRPVPNAHAPAPSEPDATPLPTARDRDADPTWTLRFSPSPPKSADASPAPGS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 56%, Pig - 68%

Alternative gene names: /

Alternative protein names: Undifferentiated embryonic cell transcription factor 1

Protein name: undifferentiated embryonic cell transcription factor 1

Full length: 341 amino acids

Entry name: UTF1_HUMAN

• SKU: ASBPP-3339-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3339-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 8433