Recombinant Human UTP20 Protein

Recombinant Human UTP20 Protein
SKU
ASBPP-10369-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O75691

Gene Name: UTP20

Expression System: Escherichia coli

Molecular Weight: 20 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 83%

Start Site: Glu761

End Site: Ala910

Coverage: 0.05

Isoelectric Point: 5

Core Sequence: EHLEKAATHAEKELQNDMTDEKSVGDESWEQTQEGDVGALYHEQLALKTDCQERLDHTNFRFLLWRALTKFPERVEPRSRELSPLFLRFINNEYYPADLQVAPTQDLRRKGKGMVAEEIEEEPAAGDDEELEEEAVPQDESSQKKKTRRA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 83%, Pig - 87%, Cynomolgus monkey - 98%

Alternative gene names: DRIM

Alternative protein names: Small subunit processome component 20 homolog; Down-regulated in metastasis protein; Novel nucleolar protein 73; NNP73; Protein Key-1A6

Protein name: UTP20 small subunit processome component

Full length: 2785 amino acids

Entry name: UTP20_HUMAN
More Information
SKU ASBPP-10369-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10369-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 27340
Product information (PDF)
×
MSDS (PDF)
×