Recombinant Human UTP25 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q68CQ4

Gene Name: UTP25

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 86%

Start Site: Lys21

End Site: Glu90

Coverage: 0.11

Isoelectric Point: 4.5

Core Sequence: KKHLRDFGEEHPFYDRVSRKEAKPQICQLSESSDSSDSESDSESEPQQVSGYHRLLATLKNVSEEEEEDE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 86%, Rat - 86%, Pig - 89%, Cynomolgus monkey - 95%

Alternative gene names: C1orf107; DEF; DIEXF

Alternative protein names: U3 small nucleolar RNA-associated protein 25 homolog; Digestive organ expansion factor homolog; UTP25 small subunit processor component

Protein name: UTP25 small subunit processome component

Full length: 756 amino acids

Entry name: UTP25_HUMAN

• SKU: ASBPP-10484-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10484-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 27042