Recombinant Human UTP6 Protein

Recombinant Human UTP6 Protein
SKU
ASBPP-10443-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NYH9

Gene Name: UTP6

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 86%

Start Site: Asp211

End Site: Leu320

Coverage: 0.20

Isoelectric Point: 4.5

Core Sequence: DYSEEILKGELAWIIYKNSVSIIKGAEFHVSLLSIAQLFDFAKDLQKEIYDDLQALHTDDPLTWDYVARRELEIESQTEEQPTTKQAKAVEVGRKEERCCAVYEEAVKTL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 86%, Pig - 89%, Cynomolgus monkey - 97%

Alternative gene names: C17orf40; HCA66; MHAT

Alternative protein names: U3 small nucleolar RNA-associated protein 6 homolog; Hepatocellular carcinoma-associated antigen 66; Multiple hat domains protein

Protein name: UTP6 small subunit processome component

Full length: 597 amino acids

Entry name: UTP6_HUMAN
More Information
SKU ASBPP-10443-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10443-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 55813
Product information (PDF)
×
MSDS (PDF)
×