Recombinant Human VAMP5 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O95183

Gene Name: VAMP5

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Gln11

End Site: Arg70

Coverage: 0.61

Isoelectric Point: 6.5

Core Sequence: QQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Rat - 76%, Pig - 79%, Cynomolgus monkey - 80%

Alternative gene names: /

Alternative protein names: Vesicle-associated membrane protein 5; VAMP-5; Myobrevin

Protein name: vesicle associated membrane protein 5

Full length: 116 amino acids

Entry name: VAMP5_HUMAN

• SKU: ASBPP-3632-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3632-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 10791