Note: Dry Ice fees will be extra-charged
Uniprot: O95292
Gene Name: VAPB
Expression System: Escherichia coli
Molecular Weight: 10.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 78%
Start Site: Lys131
End Site: Ala210
Coverage: 0.34
Isoelectric Point: 7
Core Sequence: KPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISA
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 78%, Rat - 74%, Pig - 88%, Cynomolgus monkey - 100%
Alternative gene names: /
Alternative protein names: Vesicle-associated membrane protein-associated protein B/C; VAMP-B/VAMP-C; VAMP-associated protein B/C; VAP-B/VAP-C
Protein name: VAMP associated protein B and C
Full length: 243 amino acids
Entry name: VAPB_HUMAN
Product panel: Neurodegenerative Diseases Marker,Neuroscience Biomarkers
English
Deutsch
