Recombinant Human VENTX Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O95231

Gene Name: VENTX

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 53%

Start Site: Ala91

End Site: Ser160

Coverage: 0.31

Isoelectric Point: 11.5

Core Sequence: APRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQNRRMKHKRQMQDPQLHSPFS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 53%, Rat - 59%, Pig - 54%, Cynomolgus monkey - 91%

Alternative gene names: HPX42B; VENTX2

Alternative protein names: Homeobox protein VENTX; VENT homeobox homolog; VENT-like homeobox protein 2

Protein name: VENT homeobox

Full length: 258 amino acids

Entry name: VENTX_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3367-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3367-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 27287