Recombinant Human WDR1 Protein

Recombinant Human WDR1 Protein
SKU
ASBPP-031-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O75083

Gene Name: WDR1

Expression System: Escherichia coli

Molecular Weight: 42 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Ser11

End Site: Ile260

Coverage: 0.42

Isoelectric Point: 7

Core Sequence: SLPQVERGVSKIIGGDPKGNNFLYTNGKCVILRNIDNPALADIYTEHAHQVVVAKYAPSGFYIASGDVSGKLRIWDTTQKEHLLKYEYQPFAGKIKDIAWTEDSKRIAVVGEGREKFGAVFLWDSGSSVGEITGHNKVINSVDIKQSRPYRLATGSDDNCAAFFEGPPFKFKFTIGDHSRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHLLSASGDKTSKI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: WD repeat-containing protein 1; Actin-interacting protein 1; AIP1; NORI-1

Protein name: WD repeat domain 1

Full length: 606 amino acids

Entry name: WDR1_HUMAN
More Information
SKU ASBPP-031-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-031-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 9948
Product information (PDF)
×
MSDS (PDF)
×