Recombinant Human WDR1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O75083

Gene Name: WDR1

Expression System: Escherichia coli

Molecular Weight: 34 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Lys81

End Site: Arg370

Coverage: 0.49

Isoelectric Point: 7.5

Core Sequence: KLRIWDTTQKEHLLKYEYQPFAGKIKDIAWTEDSKRIAVVGEGREKFGAVFLWDSGSSVGEITGHNKVINSVDIKQSRPYRLATGSDDNCAAFFEGPPFKFKFTIGDHSRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDVSVNSVVSTFPMGSTVLDQQLGCLWQKDHLLSVSLSGYINYLDRNNPSKPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGENDSFAGKGHTNQVSR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 96%, Pig - 97%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: WD repeat-containing protein 1; Actin-interacting protein 1; AIP1; NORI-1

Protein name: WD repeat domain 1

Full length: 606 amino acids

Entry name: WDR1_HUMAN

• SKU: ASBPP-032-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-032-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 9948