Recombinant Human WNK2 Protein

Recombinant Human WNK2 Protein
SKU
ASBPP-2962-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y3S1

Gene Name: WNK2

Expression System: Escherichia coli

Molecular Weight: 17 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Gln1181

End Site: Lys1310

Coverage: 0.06

Isoelectric Point: 6

Core Sequence: QERASRPRLTILNVCNTGDKMVECQLETHNHKMVTFKFDLDGDAPDEIATYMVEHDFILQAERETFIEQMKDVMDKAEDMLSEDTDADRGSDPGTSPPHLSTCGLGTGEESRQSQANAPVYQQNVLHTGK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 62%, Pig - 96%, Cynomolgus monkey - 62%

Alternative gene names: KIAA1760; PRKWNK2; SDCCAG43

Alternative protein names: Serine/threonine-protein kinase WNK2; Antigen NY-CO-43; Protein kinase lysine-deficient 2; Protein kinase with no lysine 2; Serologically defined colon cancer antigen 43

Protein name: WNK lysine deficient protein kinase 2

Full length: 2297 amino acids

Entry name: WNK2_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-2962-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2962-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 65268
Product information (PDF)
×
MSDS (PDF)
×