Note: Dry Ice fees will be extra-charged
Uniprot: P98170
Gene Name: XIAP
Expression System: Escherichia coli
Molecular Weight: 11.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 84%
Start Site: Cys351
End Site: Ser430
Coverage: 0.18
Isoelectric Point: 5.5
Core Sequence: CLVRTTEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSMQDESSQTS
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Rat - 82%, Pig - 88%, Cynomolgus monkey - 99%
Alternative gene names: API3; BIRC4; IAP3
Alternative protein names: E3 ubiquitin-protein ligase XIAP; Baculoviral IAP repeat-containing protein 4; IAP-like protein; ILP; hILP; Inhibitor of apoptosis protein 3; IAP-3; hIAP-3; hIAP3; RING-type E3 ubiquitin transferase XIAP; X-linked inhibitor of apoptosis protein; X-linked IAP
Protein name: X-linked inhibitor of apoptosis
Full length: 497 amino acids
Entry name: XIAP_HUMAN
Product panel: E3 Ligase,Enzyme
English
Deutsch
