Recombinant Human XRN2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H0D6

Gene Name: XRN2

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Lys421

End Site: Ala530

Coverage: 0.12

Isoelectric Point: 9.5

Core Sequence: KRKRMKRDQPAFTPSGILTPHALGSRNSPGSQVASNPRQAAYEMRMQNNSSPSISPNTSFTSDGSPSPLGGIKRKAEDSDSEPEPEDNVRLWEAGWKQRYYKNKFDVDAA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Pig - 94%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: 5'-3' exoribonuclease 2; DHM1-like protein; DHP protein

Protein name: 5'-3' exoribonuclease 2

Full length: 950 amino acids

Entry name: XRN2_HUMAN

Product panel: DNA binding & Chromatin,Enzyme

• SKU: ASBPP-3375-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3375-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 22803