Recombinant Human YBEY Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P58557

Gene Name: YBEY

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 79%

Start Site: Gly31

End Site: Asp110

Coverage: 0.53

Isoelectric Point: 6

Core Sequence: GVQKFDLGIICVDNKNIQHINRIYRDRNVPTDVLSFPFHEHLKAGEFPQPDFPDDYNLGDIFLGVEYIFHQCKENEDYND

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Pig - 72%, Cynomolgus monkey - 94%

Alternative gene names: C21orf57

Alternative protein names: Endoribonuclease YbeY

Protein name: ybeY metalloendoribonuclease

Full length: 167 amino acids

Entry name: YBEY_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3421-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3421-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 54059