Recombinant Human YEATS4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O95619

Gene Name: YEATS4

Expression System: Escherichia coli

Molecular Weight: 39 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Met1

End Site: Ile227

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: GAS41

Alternative protein names: YEATS domain-containing protein 4; Glioma-amplified sequence 41; Gas41; NuMA-binding protein 1; NuBI-1; NuBI1

Protein name: YEATS domain containing 4

Full length: 227 amino acids

Entry name: YETS4_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3431-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3431-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 8089